LL-37
Cathelicidin-derived antimicrobial peptide (37 amino acids). Researched for innate immunity, antimicrobial activity, and wound-healing pathways. ≥98% HPLC purity with Janoshik CoA.
€32.99
5mg
This product is currently sold out.
Payment Methods
|
SEPA
|Crypto
What is LL-37?
LL-37 is a 37-amino-acid cathelicidin-derived peptide and one of the most widely studied human antimicrobial peptides (AMPs). It is produced by neutrophils, epithelial cells, and other immune cells as part of the innate immune defense system.
Why It Matters
LL-37 sits at the intersection of antimicrobial, immunomodulatory, and tissue-repair research. It's one of the few endogenous peptides that acts on both microbial membranes and host cell signaling, a dual mechanism that has drawn interest across infection, inflammation, and wound-healing models.
Key Research Areas
- Antimicrobial activity - broad-spectrum disruption of bacterial, fungal, and viral membranes in vitro
- Immunomodulation - chemotactic and cytokine-modulating effects on immune cells
- Wound healing - angiogenesis, epithelial migration, and granulation tissue formation in preclinical models
- Barrier function - epithelial defense and skin microbiome research
Product Specifications
- Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
- 37 amino acids, ~4.5 kDa
- Purity: ≥98% HPLC verified
- Independent Janoshik Analytical certificate of analysis
- Lyophilized powder, for research use only
